PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G139800.1
Common NameB456_009G139800, LOC105770915
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 252aa    MW: 27011.4 Da    PI: 8.4766
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G139800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.4e-401777262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++++lkcprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  Gorai.009G139800.1 17 EQEQLKCPRCDSTNTKFCYYNNYNLAQPRHFCKSCRRYWTKGGALRNIPVGGGTRKNSKRS 77
                        57899****************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-281372IPR003851Zinc finger, Dof-type
PfamPF027012.8E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MQDPTGFQQM KAPVFPEQEQ LKCPRCDSTN TKFCYYNNYN LAQPRHFCKS CRRYWTKGGA  60
LRNIPVGGGT RKNSKRSSSS SDSSSQPKRQ SNPAPDSIRN QNLPDSSPPP TIPQQVLLSS  120
AVQNSVSNAD QTRMYVLSLD HQARKMTDSG GSFSSLLASS GQFGNLLNGL NPNGSGSETA  180
HTDDFGGNLA SGRGIGPSSD RDPRLRESNN NNDESYFGVQ GGGGGGDTNC WTGCSNGWPD  240
LAIYTPGSSF H*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447736.10.0PREDICTED: dof zinc finger protein DOF3.1
SwissprotO821558e-42DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A0D2QFK30.0A0A0D2QFK3_G
STRINGGLYMA07G01461.15e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-38DOF zinc finger protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]